Protein Info for TX73_024905 in Rhodopseudomonas palustris CGA009

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02937: RNA polymerase sigma factor, sigma-70 family
  • amino acids 37 to 192 (156 residues), 112.8 bits, E=6.3e-37
• PF04542: Sigma70_r2
  • amino acids 41 to 107 (67 residues), 56.7 bits, E=3.5e-19
• PF08281: Sigma70_r4_2
  • amino acids 137 to 189 (53 residues), 47 bits, E=3.1e-16
• PF04545: Sigma70_r4
  • amino acids 142 to 189 (48 residues), 48.9 bits, E=7.2e-17

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 99% identity to rpx:Rpdx1_4981)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Protein Sequence (203 amino acids)

>TX73_024905 sigma-70 family RNA polymerase sigma factor (Rhodopseudomonas palustris CGA009)
MQNVIALNDAGRLGILAARATSDEMLLASIANGDRTAMHTLYARHNVRVYRFILRMVRDA
ATAEDLVSQVFLDVWRTARQFEGRAQVSTWLLSIARFKALTALRQRQHEDIDQDDVLEIA
DGSDSPETALDRSRTSDILRACIAKLSPAHREIINLVYYHEKSVEEVGRIVGIPQSTVKT
RMFYARKQLAELLKRHGVESLAA