Protein Info for TX73_024895 in Rhodopseudomonas palustris CGA009

Annotation: DUF3369 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 PF11849: DUF3369" amino acids 148 to 312 (165 residues), 158 bits, see alignment E=3.9e-50 PF00512: HisKA" amino acids 351 to 416 (66 residues), 32.9 bits, see alignment E=8.4e-12 PF02518: HATPase_c" amino acids 465 to 576 (112 residues), 94.9 bits, see alignment E=6.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_5276)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>TX73_024895 DUF3369 domain-containing protein (Rhodopseudomonas palustris CGA009)
MADQDDILELIEDTDSTPEVSGARKWKIAVIDDDTAVHDGTRFALSDYSLNNQGLEILSA
YSGAEGRELMRAHPDIAAVLLDVIMETDAAGLDLVEFIRNDLKNETVRIILRTGQPGQAP
ERRVIVDYDINDYKAKTELTADKLFTSLTAALRSYQQLERMVQTRRGLEIIIDAASTLYD
FKSMQRLAEGVLTQLASLLNVDCAGILVLRDAGDELAVLAGSGCYSRFIGTTGHSNSLDP
DLRQMVEEAFRRRKHEFADHRTVLYIRTGSGREVVVLLQAERELSDTDRSLVEIFGSRLS
IAFDNVILYRQLHEANTQLEERVAQRTRALTQANRRLSTQWLRLQRANAFKNEILGTVAH
DLKNPLGVILGRTEMLTELIGAESSKDHVIAQVDHIRDATRRLTLMVDHLISDAMADAFD
ISIRREAVDIAALVGEVAEANRPMAQNKQQVISVSTPEACSTMCDSDRMREAIDNLVSNA
IKYSPIGGNIALQVDGDGDSTMIRVTDEGAGLSPEDLSRLFGRFQRLSAKPTAGESSTGL
GLSIVKKIVDMHGGEIIAESPGPGQGSTFTIILPAASVS