Protein Info for TX73_024880 in Rhodopseudomonas palustris CGA009

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13560: HTH_31
  • amino acids 33 to 91 (59 residues), 42.7 bits, E=1.5e-14
• PF13443: HTH_26
  • amino acids 39 to 93 (55 residues), 23 bits, E=1.9e-08
• PF01381: HTH_3
  • amino acids 39 to 92 (54 residues), 44.5 bits, 3.1e-15
• PF01202: SKI
  • amino acids 149 to 305 (157 residues), 136 bits, E=3.1e-43

Best Hits

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 99% identity to rpt:Rpal_5273)

Predicted SEED Role

"Regulatory protein of benzoate catabolism" in subsystem Benzoate transport and degradation cluster

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (40/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.71

Protein Sequence (324 amino acids)

>TX73_024880 helix-turn-helix transcriptional regulator (Rhodopseudomonas palustris CGA009)
MAGDFGQHYHSPNRCERTEMAEPDDTDASFLLDLGRHVRTMRGRRGMSRKVLAKVSGISE
RYIAQLESGKGNVSIMLLRRISEALATPLEDLLPSNESSADWPVIRDLVRRATPVQIAHA
KDVLSGLGRYGGSLEREATFHGIGLIGLRGAGKSTLGKMLADSIGWSFVELNREIERQNG
LSVSEIIALYGQEGFRRMEQTALSRLLARKEPIVLATGGGIVSEPITFDQILTSFYTIWL
KAEPEEHMSRVRGQGDLRPMADDRAAMQELRTILQSREPLYARAAGVLDTAGLSVEAAAQ
KLVAMVSPVLSRDAGAFGLREATP