Protein Info for TX73_024855 in Rhodopseudomonas palustris CGA009

Annotation: lysylphosphatidylglycerol synthase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 267 to 283 (17 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 100% identity to rpt:Rpal_5268)

Predicted SEED Role

"FIG01005391: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>TX73_024855 lysylphosphatidylglycerol synthase domain-containing protein (Rhodopseudomonas palustris CGA009)
MRIAIRRTIEVLREKQILHKLGVAVSIAVIAAACYVLYHILRGIDHDRVLDAMGQTEPTS
IALAALFVAAGYFTLTFYDLFAVHAIGRDDVPYRVNALAAFTSYSIGHNVGASALTGGAV
RYRIYSAWGLDAIDVAKVCFLAGLTFWLGNAAVLGLGVAYHPEAASAVDLLPPAVNRVLA
LLILAGLMVYVAWVSFKPRCVGRGSWTVTLPGGKLTLLQIAIGIVDLGFCALAMYVLTPD
EPNVGFVVVAVIFVSATLLGFASHSPGGLGVFDAAMLVGLWQMDKEELLAGMLLFRLLYY
IVPFVISVLVLAVREIVLGARLKRVPPLAEALKPKPVRGDPSPG