Protein Info for TX73_024850 in Rhodopseudomonas palustris CGA009

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details PF00512: HisKA" amino acids 217 to 281 (65 residues), 65 bits, see alignment E=5.2e-22 PF02518: HATPase_c" amino acids 329 to 444 (116 residues), 86.5 bits, see alignment E=1.8e-28

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to rpa:RPA4781)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>TX73_024850 ATP-binding protein (Rhodopseudomonas palustris CGA009)
MTTAPAPDEQARPVRELVLAPPPPSSTSLLTHWSDRLRHAAIILIAAALALTALVLFAQL
AIGPAIAAFACLVAAALVPWRLHDGSNALDDALGVSPVEMPVVRAIVGGMPDPAVLLDRA
GRVIHLNAAAAQLAPALRVRELAQFALRSPEIVTALREAIATSEPRRVTYLDHGSIERWL
ELIIAPVQVPTAFGGTDQCMLMTFHDLTPLRRVEEMRADFVANASHELRTPLAALSGFID
TLQGQARDDPKARERFLGIMHAQATRMARLIDDLLSLSRVELSAHVRPDAMIDLKPLIKQ
VTDGLEPLAKERQVVIELELPEDAATIAGDREELLRLFENLIENALKYGASGGRVVVSVV
AAVSGDGVPEYRALVRDFGPGIAPEHLPRLTERFYRVDVGDSRSQGGTGLGLSLVKHIVN
RHRGRLLIESVLKKGATFTVCFPQGKPQV