Protein Info for TX73_024790 in Rhodopseudomonas palustris CGA009

Annotation: OpgC domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 110 (26 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 205 to 224 (20 residues), see Phobius details amino acids 236 to 253 (18 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 374 to 398 (25 residues), see Phobius details PF10129: OpgC_C" amino acids 44 to 399 (356 residues), 459.6 bits, see alignment E=3.6e-142

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4769)

Predicted SEED Role

"Bll4413 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>TX73_024790 OpgC domain-containing protein (Rhodopseudomonas palustris CGA009)
MTPPVTTVAEPVTGAPPAGGPPTEPAAPPPLPAASPPRKVVPKRELRLDLFRGLALWLIF
IDHLPANVLTWFTLRNYGFSDATEIFIFISGYTAAFVYGKAMTELGFVVAAARILKRVWQ
IYVAHVFLFTIFLAEISYVATSFQNPLYSEEMGILDFLKQPDVTIVQALLLRFRPVNMDV
LPLYIVLMFFLPPILWLMRRWPDITLGLATLLYAATWQFDLHLTAYPSGAWVFNPYAWQL
LFVFGAWCAMGGAKRLSRVLASKVTLWLAAAYLVAAFYVTLTWYTPQLFHTLPKWLEQWM
YPIDKPNLDVLRFAHFLALAALTVRFIPRDWPALNSPWLRPLILCGQHSLEIFCIGIFLA
FAGYFILAEVSGGAVLHFFVSVTGICIMSAAAWLFSWYKNVASKAGSRTPPDADLAGGDA
A