Protein Info for TX73_024695 in Rhodopseudomonas palustris CGA009

Annotation: YihY/virulence factor BrkB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 7 to 21 (15 residues), see Phobius details amino acids 23 to 27 (5 residues), see Phobius details amino acids 29 to 53 (25 residues), see Phobius details amino acids 90 to 105 (16 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 242 to 266 (25 residues), see Phobius details PF03631: Virul_fac_BrkB" amino acids 21 to 275 (255 residues), 158.4 bits, see alignment E=1.4e-50

Best Hits

KEGG orthology group: K07058, membrane protein (inferred from 100% identity to rpa:RPA4752)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>TX73_024695 YihY/virulence factor BrkB family protein (Rhodopseudomonas palustris CGA009)
MRQIRYAYAVAVDALYTFLADDGWAIASHIALSTLMALFPFLIVLTSLAGFVGSRELADS
AAELLLDVWPAQVASTLSGEIHDVLTTTRGGVLTIGLVLALYFASNGVESLRVGLNRAYA
VIEPRPWYLLRLESIGYTLVAAFTALAMGFLIVLGPLIVATARHYVPLLVHDNEPLLTFA
RYGIAITALTVALFLLHAYLPAGRRSFRQILPGIVFTITASLISGMTFGMYLARFANNYV
SMYAGLASVIIALVFLYFIAAIFVYGGELNAAIIKSRLPEGTTLQEAQLRAPGAKPV