Protein Info for TX73_024660 in Rhodopseudomonas palustris CGA009

Annotation: NAD(P)H-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02525: Flavodoxin_2
  • amino acids 1 to 214 (214 residues), 179.4 bits, E=7.3e-57
• PF03358: FMN_red
  • amino acids 1 to 155 (155 residues), 41.6 bits, E=9.8e-15

Best Hits

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 100% identity to rpa:RPA4746)

MetaCyc: 74% identical to roxarsone nitroreductase (Sinorhizobium meliloti)
1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)
• roxarsone (and nitarsone) degradation IV (2/6 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.- or 1.7.1.M3

Protein Sequence (266 amino acids)

>TX73_024660 NAD(P)H-dependent oxidoreductase (Rhodopseudomonas palustris CGA009)
MKVLLVFAHPEPRSLNGALRDVAVAELQRLGHEVQVSDLYAMGWKPAIDRADFPNLASDE
RLLPTEASKAAFGAGELTQDVRDEIDKLLWADVVILQFPLWWFSMPAILKGWVERVFACG
FAYGVGEHSDKRWGNRYGEGVLAGKRAMLIVTTGGWEQHYGPRGINGPIDDLLFPIHHGI
LFYPGCEVLPPYVLYQAGRLDSVGFETAAERLRARMRTLAETPPIPYRRQNGGDYLIPAM
ELRPELGEPGAEGFAVHLSQEVGSSA