Protein Info for TX73_024650 in Rhodopseudomonas palustris CGA009

Annotation: TlpA disulfide reductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details PF08534: Redoxin" amino acids 80 to 214 (135 residues), 94.2 bits, see alignment E=1.4e-30 PF00578: AhpC-TSA" amino acids 81 to 195 (115 residues), 72.8 bits, see alignment E=4.8e-24 PF13905: Thioredoxin_8" amino acids 101 to 195 (95 residues), 41.8 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 66% identical to TLPA_BRADU: Thiol:disulfide interchange protein TlpA (tlpA) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4744)

Predicted SEED Role

"Thiol:disulfide oxidoreductase TlpA" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>TX73_024650 TlpA disulfide reductase family protein (Rhodopseudomonas palustris CGA009)
MTESQPNSVPPRRAGRLTILLATIAVLVVAGAAGIYGIGGLQRNAGGDPVCRPAVALAQQ
LKPLVRGEVAALTPAAAPLRLPDLTFADDGGQPKKLSDFRGRTVLVNLWATWCVPCRKEM
PALDNLQAKLGSSDFEVVAINIDTRDPAKPKKFLDDEKLTHLSVFTDASAKVFQDLKAVG
RALGMPTSVLIDREGCEIATINGPAEWDSNDATTLIKAAVKPVAGSSK