Protein Info for TX73_024645 in Rhodopseudomonas palustris CGA009

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 5 to 453 (449 residues), 586.4 bits, E=2.3e-180
• PF00206: Lyase_1
  • amino acids 8 to 302 (295 residues), 271.6 bits, E=1.1e-84
• PF14698: ASL_C2
  • amino acids 365 to 434 (70 residues), 92.6 bits, E=1.7e-30

Best Hits

Swiss-Prot: 100% identical to ARLY_RHOPT: Argininosuccinate lyase (argH) from Rhodopseudomonas palustris (strain TIE-1)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to rpa:RPA4743)

MetaCyc: 43% identical to argininosuccinate lyase (Homo sapiens)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• urea cycle (4/5 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (465 amino acids)

>TX73_024645 argininosuccinate lyase (Rhodopseudomonas palustris CGA009)
MSNKMWGGRFTDRPDAIMEEINVSIDVDRHLYAQDITASKAHAAMLAAQGIITANDAKNI
GKGLDTILSEITAGKFTFKRALEDIHMNVESRLAELIGPAAGRLHTARSRNDQVATDFRL
YVRDVLDETDAALAALQQALAERALEQADTVMPGFTHLQTAQPVTFGHHLMAYVEMVARD
RGRFQDARKRLNESPLGAAALAGTSFPIDRHATAAKLGFDRPMANSLDAVSDRDFVLETL
SAASICAVHLSRFAEEIVIWTSPLVGLIRLSDKFTTGSSIMPQKRNPDAAELVRAKTGRV
IGALNGLLIVMKGLPLAYQKDMQEDKQGAMEGFAALSLAIRAITGMVRDLEPEPERMKLA
AGEGYATATDLADWLVRTLKMPFREAHHVTGRIVGLAAKKGVALHELPLAEMQSVEKRIT
KDVLAVLSVESSVKSRTSYGGTAPKNVRSQAKAWLKRLAKDTKTR