Protein Info for TX73_024605 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 46 to 70 (25 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 297 to 315 (19 residues), see Phobius details

Best Hits

KEGG orthology group: K09811, cell division transport system permease protein (inferred from 100% identity to rpt:Rpal_5217)

Predicted SEED Role

"Cell division protein FtsX" in subsystem Bacterial Cell Division

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>TX73_024605 ABC transporter permease (Rhodopseudomonas palustris CGA009)
MNRQGPLRRADERDVMVDLGHERPQVPPKARNASPIVPRASISGRALVAVVAIMTFLASM
TTGVVMLISASAAEWQSEVSSELTVQVRSLRGRDLDRDADRVAEVVRSQPGVVEVRTFTK
DESAKLLEPWLGTGLSLDDLPVPRVIVARAAPGSGLDLAELRRRVTEAAPSATVDDHRAW
IERMRSMTGATVFAGIGVLGLVIVATVISVSFATRGAMAANRPIVEVLHFVGASDSYIAN
RFFRHFLLLGLQGGLIGGGAAIFVFGFSESVATWFSGTPVGDQFAALLGTFSLRPTGYLA
LAGMAVLIAGITALASRRTLFSTLNSIE