Protein Info for TX73_024445 in Rhodopseudomonas palustris CGA009

Annotation: phosphoribosyl-ATP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 88 (84 residues), 87.7 bits, E=2.3e-29
• PF01503: PRA-PH
  • amino acids 7 to 91 (85 residues), 61.7 bits, E=3.4e-21

Best Hits

Swiss-Prot: 100% identical to HIS22_RHOPA: Phosphoribosyl-ATP pyrophosphatase 2 (hisE2) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 99% identity to rpt:Rpal_5186)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.31

Use Curated BLAST to search for 3.6.1.31

Protein Sequence (131 amino acids)

>TX73_024445 phosphoribosyl-ATP diphosphatase (Rhodopseudomonas palustris CGA009)
MADSLDRLYQAVLAARDLDPATSRTARLFQRGSGKMAKKLAEEAIEVVIDAVNGNREAVI
RESADLLYNLTVLWASAGVRPEDVWAEMRRRENLLGIAEKLPKSRIGKPAAPHATRRPVI
PQEARAVRKHR