Protein Info for TX73_024285 in Rhodopseudomonas palustris CGA009

Annotation: homogentisate 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01015: homogentisate 1,2-dioxygenase" amino acids 20 to 443 (424 residues), 682.2 bits, see alignment E=1.3e-209 PF20510: HgmA_N" amino acids 21 to 290 (270 residues), 402.8 bits, see alignment E=7.4e-125 PF04209: HgmA_C" amino acids 292 to 443 (152 residues), 249.9 bits, see alignment E=8.4e-79

Best Hits

Swiss-Prot: 100% identical to HGD_RHOPA: Homogentisate 1,2-dioxygenase (hmgA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00451, homogentisate 1,2-dioxygenase [EC: 1.13.11.5] (inferred from 100% identity to rpt:Rpal_5153)

Predicted SEED Role

"Homogentisate 1,2-dioxygenase (EC 1.13.11.5)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 1.13.11.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>TX73_024285 homogentisate 1,2-dioxygenase (Rhodopseudomonas palustris CGA009)
MNINAAPQILGRSSQDITPGYMSGFGNSFETEALPGALPVGRNSPQRCAYGLYAEQLSGS
PFTAPRGANERSWLYRIRPSVKHSGRFAKTDMGLWRSAPCFEHDLPIAQLRWDPPPMPQE
ALTFLQGVRTMTTAGDVNTQAGMATHLYLITQSMVDQHFYNADGEMMFVPQQGSLRLVTE
FGIITIEPAEIAVIPRGVKFRVELVDGPARGYLCENYGGAFTLPERGPIGANCLANSRDF
LTPVAAYEDKDTPTELYVKWGGSLYVTKLPHSPIDVVAWHGNYAPYKYDLRTYSPVGAIG
FDHPDPSIFTVLTSPSETPGTANIDFVIFPERWMVADNTFRPPWYHMNIMSEFMGLIYGV
YDAKPQGFVPGGASLHNMMLPHGPDREAFDHASNGELKPVKLTGTMAFMFETRYPQRVTE
YAASSGLLQDDYADCWNGLEKRFDPNRP