Protein Info for TX73_024280 in Rhodopseudomonas palustris CGA009

Annotation: maleylacetoacetate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 PF13417: GST_N_3" amino acids 12 to 89 (78 residues), 45.7 bits, see alignment E=1.4e-15 TIGR01262: maleylacetoacetate isomerase" amino acids 12 to 217 (206 residues), 266.7 bits, see alignment E=6.7e-84 PF02798: GST_N" amino acids 12 to 83 (72 residues), 39.9 bits, see alignment E=8.9e-14 PF13409: GST_N_2" amino acids 18 to 84 (67 residues), 37.1 bits, see alignment E=8.2e-13 PF13410: GST_C_2" amino acids 142 to 187 (46 residues), 30.9 bits, see alignment 4.8e-11

Best Hits

Swiss-Prot: 48% identical to MAAI_VIBCH: Probable maleylacetoacetate isomerase (maiA) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01800, maleylacetoacetate isomerase [EC: 5.2.1.2] (inferred from 100% identity to rpt:Rpal_5152)

MetaCyc: 49% identical to glutathione transferase subunit (Escherichia coli B)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Maleylacetoacetate isomerase (EC 5.2.1.2) @ Glutathione S-transferase, zeta (EC 2.5.1.18)" (EC 2.5.1.18, EC 5.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18 or 5.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>TX73_024280 maleylacetoacetate isomerase (Rhodopseudomonas palustris CGA009)
MTKAQDHDAAVLYGYFRSSASYRVRIALNLKNIIVAQRYVHLRNGEQNLEAFRWINPAGM
VPYWSEGEFNLGQSLAIIEYLDETHPEPPLLPKDPKARAIVREIAYAVACDIHPIGNLRI
LKRLTELGVDEVDRARWSKEWVEQGFAAIEARLAQTPGPFAYGDRPTLADICIVPQIFNA
RRFDADLAPFERIRQIEAEAMKLDAFVAAEPGRQPDAE