Protein Info for TX73_024255 in Rhodopseudomonas palustris CGA009

Annotation: (2Fe-2S)-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 7 to 60 (54 residues), 30.4 bits, E=3e-11
• PF01799: Fer2_2
  • amino acids 74 to 147 (74 residues), 103.5 bits, E=5.4e-34

Best Hits

Swiss-Prot: 57% identical to CUTC_SULAC: Glyceraldehyde dehydrogenase small chain (cutC) from Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)

KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 99% identity to rpx:Rpdx1_4842)

MetaCyc: 57% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-

Predicted SEED Role

"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

• D-xylose degradation IV (4/7 steps found)
• L-arabinose degradation IV (4/8 steps found)
• superpathway of pentose and pentitol degradation (9/42 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.99.2

Protein Sequence (161 amino acids)

>TX73_024255 (2Fe-2S)-binding protein (Rhodopseudomonas palustris CGA009)
MSKVSMTVNGKLVTADVEDRTLLVHLLRDHLGLTGTHVGCDTSQCGCCVVHIDGRAVKSC
TTLVGQVDGANITTIEGISKGDELHPMQAAFRDNHGLQCGYCTPGMIMSAIDIVHRYGGN
LDEETVRHELEGNICRCTGYHNIVKSVLDAASRMNVAQAAE