Protein Info for TX73_024145 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF00005: ABC_tran" amino acids 48 to 189 (142 residues), 125.7 bits, see alignment E=3.1e-40 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 62 to 380 (319 residues), 369.2 bits, see alignment E=8.7e-115 PF08402: TOBE_2" amino acids 305 to 380 (76 residues), 65.3 bits, see alignment E=6.8e-22

Best Hits

Swiss-Prot: 44% identical to POTA1_PSEAE: Spermidine/putrescine import ATP-binding protein PotA 1 (potA1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to rpt:Rpal_5131)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (381 amino acids)

>TX73_024145 ABC transporter ATP-binding protein (Rhodopseudomonas palustris CGA009)
MAEPVALRAGGFGARGAGSQAAQERQVIGSSIAVREAEKRYGQFHAVDRINLDIEPGEFI
TLLGPSGSGKTTLLNLLAGFQTLDGGEILVDGKPVHNVPTHKRGFGMVFQSYALFPNMTV
TQNVAFPLRMAGVDRATTARRVAETLEIMRLSAHANKSPSEMSGGQQQRVAIARAIVMRP
KVVLMDEPLSALDRRLRESIQIEIRDLHQTIGSTILFVTHDQGEALTMSDRIAVLDAGKI
VQIGRPLDIYRHPANRFVASFVGESNLIEAEIMQKRGTTVTLKNRSGYVFDAESRDAIDV
GRVTVLVRPERIAIADEPTANSTPVTVTSAIFLGETLRIEAQMESGETLLVRCPDSAKRP
LPNVGDRLHVGWGPEDCWVLA