Protein Info for TX73_023920 in Rhodopseudomonas palustris CGA009

Annotation: electron transfer flavoprotein subunit beta/FixA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01012: ETF
  • amino acids 23 to 214 (192 residues), 142.1 bits, E=9.2e-46

Best Hits

Swiss-Prot: 79% identical to FIXA_AZOC5: Protein FixA (fixA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K03521, electron transfer flavoprotein beta subunit (inferred from 100% identity to rpa:RPA4605)

MetaCyc: 63% identical to quinone reductase (NADH,flavodoxin) complex electron transfer flavoprotein component alpha subunit (Azotobacter vinelandii)

Predicted SEED Role

"Electron transfer flavoprotein, beta subunit" in subsystem Acetyl-CoA fermentation to Butyrate

Protein Sequence (281 amino acids)

>TX73_023920 electron transfer flavoprotein subunit beta/FixA family protein (Rhodopseudomonas palustris CGA009)
MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEEALRLRDKFGGEVTVLT
MGPPTAEDSLRKALTIGANRAVLLTDRFFAGSDTLATSYALAAAIRKIGSTFGAVDVVFT
GKQTIDGDTAQVGPGICKRLDFLQLTYVSKVSSLDLEARTIEVERRSEGGVQVLRSNLPC
LITMLEGTNQVRRGSMINALNAARAEVVKWSAQDAGVEDIQKCGLRGSPTVVKRVFAPTP
RAEKAKVVEAAGQPPAEALIDEIFKLRPKLENEMFELARGF