Protein Info for TX73_023800 in Rhodopseudomonas palustris CGA009

Annotation: UDP-glucose 4-epimerase GalE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 156 (152 residues), 49.3 bits, E=1.1e-16
• PF01370: Epimerase
  • amino acids 6 to 255 (250 residues), 188.8 bits, E=3.4e-59
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 6 to 325 (320 residues), 433.1 bits, E=2.8e-134
• PF02719: Polysacc_synt_2
  • amino acids 6 to 177 (172 residues), 44.4 bits, E=3.7e-15
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 317 (311 residues), 162 bits, E=8e-51
• PF01073: 3Beta_HSD
  • amino acids 7 to 154 (148 residues), 37.9 bits, E=3.3e-13

Best Hits

Swiss-Prot: 56% identical to EXOB_AZOBR: UDP-glucose 4-epimerase (exoB) from Azospirillum brasilense

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to rpa:RPA4582)

MetaCyc: 46% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-β-L-arabinose biosynthesis I (from UDP-α-D-xylose) (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• UDP-sugars interconversion (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (3/7 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Protein Sequence (327 amino acids)

>TX73_023800 UDP-glucose 4-epimerase GalE (Rhodopseudomonas palustris CGA009)
MTRRHILVTGGAGYIGSHMTLALLGAGERPLVIDNLSTGSRAIVPTDVPFFEGNVGDADF
VGRIMDEHPIEAIIHFAASIVVPESVTQPLAYYGNNTANARTLLECAVNHGVPHVVFSST
AAVYGEPDRTPVEEDDPTRPINPYGRSKLMVEWMLADIAQAYPFSYAALRYFNVAGADPQ
GRAGQSTPNATHLIKIAVQAALGKRSGLDVYGTDYSTPDGSCIRDYVHVSDLAQAHLDAL
DYLRAGKPSITCNIGYANGYSVLDVINVVKRVSGVDFEVRIKGRRAGDPAALIAANQRAR
TALSWTPRYDDLEQIVRDALAWERRLG