Protein Info for TX73_023740 in Rhodopseudomonas palustris CGA009

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 160 to 189 (30 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 369 to 393 (25 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 432 to 449 (18 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4570)

Predicted SEED Role

"FIG01005626: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>TX73_023740 hypothetical protein (Rhodopseudomonas palustris CGA009)
METSIPGKVLAAQARRSNAARIALFVLPLLMLAPAIWNGYPLLQYDTGGYLARWYEGYLV
INRATSYGIYLHLGEQTQFWLNLGFQAIVSLWLIQLTLRVFGITKPFGLAAIGVGLIATT
ALPWITSMLLTDIFAGLSVLSLFLLIAYRDQTSVVEKILLFVFTAFAASTHSATMIVLTG
VCGAGWLLLPWLRGRVTASGLTLASSALVIGALLVLSCNYALSGKFTWTPGGSGVAFGRM
LQDGIVKRYLDDNCPRQQLKLCPYKDELPPTGDDFLWGGNNMFDKLGRFEGMSDEMEFIS
KQAVTAYPWMQFKAASKATWDQLVHVATGEGTNGWLPHTYGIIERYLPEQSKAMRAAKQQ
HWDINFDAVNMVHVPVALGSMVLMLVILGSALWRHRLDDVTLLAGTVTLALLGNALICGI
ISGPHDRYGSRIVWIATFTAMIAGIKYFIDDRNTADDGAD