Protein Info for TX73_023735 in Rhodopseudomonas palustris CGA009

Annotation: polyphosphate kinase 2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 TIGR03709: polyphosphate:nucleotide phosphotransferase, PPK2 family" amino acids 6 to 279 (274 residues), 401.4 bits, see alignment E=7.5e-125 PF03976: PPK2" amino acids 31 to 265 (235 residues), 227.2 bits, see alignment E=1e-71

Best Hits

Swiss-Prot: 100% identical to PK21_RHOPA: Polyphosphate:ADP phosphotransferase (RPA4569) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4569)

Predicted SEED Role

"FIG01005178: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>TX73_023735 polyphosphate kinase 2 family protein (Rhodopseudomonas palustris CGA009)
MKIKTKQFRVGEGEKVDLGKWPTKVDPFYESKEHYHELLRTQVERLSDLQQLLYASNRHA
VLLIFQAMDAAGKDGVIRHVLSGINPQGCQVFSFKHPSATELQHDFLWRTTRDLPERGRI
GVFNRSYYEEVLIVRVHPDILQSEAVPNGENFGKSFWHKRYRSIRNLEQHLHANGTRIVK
FFLHLSKDEQRKRFLARIDEPEKNWKFSAADLEERQYWDDYMDAYEKCLSETSSEDSPWY
AVPADDKENARLIVSQVIAETMESLKMSYPETTPARRKELLQMRQQLLK