Protein Info for TX73_023540 in Rhodopseudomonas palustris CGA009

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF00815: Histidinol_dh" amino acids 25 to 428 (404 residues), 551.7 bits, see alignment E=5.8e-170 TIGR00069: histidinol dehydrogenase" amino acids 35 to 427 (393 residues), 524.4 bits, see alignment E=1.1e-161

Best Hits

Swiss-Prot: 100% identical to HISX_RHOPA: Histidinol dehydrogenase (hisD) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 100% identity to rpt:Rpal_5022)

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>TX73_023540 histidinol dehydrogenase (Rhodopseudomonas palustris CGA009)
MPLRLDNASPDFASKFKAFLAMKREVAADIEAATRAIVDDVAHRGDAALLEATEKFDRLT
LDAAGMRVGEAEVEAAVKACDSETVDALKLARDRIEFFHRRQLPKDDRFTDPLGVELGWR
WSAIEAVGLYVPGGTAAYPSSVLMNAIPAKVAGVERVVMVVPSPGGTLNPLVLAAAQLAG
ATEIYRIGGAQAVAALAYGTATIAPVAKIVGPGNAYVAAAKRLVFGRVGIDMIAGPSEVV
VVADKTANPDWIAADLLAQAEHDANAQSILITDSAVLAADVERALAAQLTTLPRVKIARA
SWDEFGAIIKVAKLEDAVPLANAIAAEHLEIMTADPEAFADKIRNAGAIFLGGHTPEAIG
DYVGGSNHVLPTARSARFSSGLGVLDFMKRTSILKCGPEQLAVLGPAAMALGKAEGLDAH
ARSVGLRLNQR