Protein Info for TX73_023530 in Rhodopseudomonas palustris CGA009

Annotation: low molecular weight phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01451: LMWPc
  • amino acids 13 to 140 (128 residues), 56.7 bits, E=1.9e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_5020)

Predicted SEED Role

"Arsenate reductase (EC 1.20.4.1)" in subsystem Anaerobic respiratory reductases or Arsenic resistance (EC 1.20.4.1)

MetaCyc Pathways

• arsenic detoxification (bacteria) (3/4 steps found)
• arsenate detoxification III (1/2 steps found)
• arsenate detoxification I (3/6 steps found)
• arsenic detoxification (plants) (3/6 steps found)
• arsenic detoxification (yeast) (3/12 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.20.4.1

Use Curated BLAST to search for 1.20.4.1

Protein Sequence (155 amino acids)

>TX73_023530 low molecular weight phosphatase family protein (Rhodopseudomonas palustris CGA009)
MIPPSRTGLPHAVLFACGMNSVRSPMAEAMLRGIAPRTMYVRSAGVKTQELDPFAVAVMA
ERGLDISKHKPTTFEELDDYEGLNFDLIVTLSPEAHHKALELTRAHAVDVEYWPTYDPTG
TEGNREQKLAAYREVADSLMQRIYKRFGRHSSGNE