Protein Info for TX73_023235 in Rhodopseudomonas palustris CGA009

Annotation: YeeE/YedE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 82 to 109 (28 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 295 to 318 (24 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details PF04143: Sulf_transp" amino acids 27 to 339 (313 residues), 206.1 bits, see alignment E=4.9e-65

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to rpa:RPA4475)

Predicted SEED Role

"Lipocalin-related protein and Bos/Can/Equ allergen" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>TX73_023235 YeeE/YedE family protein (Rhodopseudomonas palustris CGA009)
MQDASAWMLALAGLCVGVTAGFFVRLARLCSFGAVEDALMGGDTRRLRIFGLALGIALLG
TQALVIAGQLDPGQSNYTAPALPLISIAIGSVLFGIGMAFVGTCGFGSLVRLGGGDLRSF
VVILVLGGAAYATLRGMFSGFRITVLERFAITMPEGVNTDLAALTQHLSGIDLRAVIAAL
GGGLLCLIALGDKRLRRTPRLLAAGVALGLLTVVGWLATTKLADPFAGPVHPQSLTFVST
VGKAVYAGLLNVANFADFGVGTVFGVIAGAFIAAWHTDELRWEAFDDDHEMRRHVAGAAL
MGFGGILTGGCTIGQGITAGSVMALSWPIAIVGMMFGARIGIAVLVDGSPRELIRRRFDA
WRELLQRRRAPALTAANRPNHRPAAPSDAPRPTAPHSLAE