Protein Info for TX73_023220 in Rhodopseudomonas palustris CGA009

Annotation: cytochrome c biogenesis protein CcdA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 130 to 161 (32 residues), see Phobius details amino acids 173 to 200 (28 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details PF02683: DsbD" amino acids 10 to 226 (217 residues), 201.9 bits, see alignment E=1.2e-63 PF13386: DsbD_2" amino acids 56 to 222 (167 residues), 36.9 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K06196, cytochrome c-type biogenesis protein (inferred from 99% identity to rpt:Rpal_4965)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcdA (DsbD analog)" in subsystem Biogenesis of c-type cytochromes or Experimental tye or Periplasmic disulfide interchange or Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>TX73_023220 cytochrome c biogenesis protein CcdA (Rhodopseudomonas palustris CGA009)
MVSNISLVGAFGAGVLSFLSPCVLPLVPPYLCFLAGVSLDQLTRGADQPSKTVDGRVVAA
SLAFVLGFSTVFVALGASASAIGKAVTDHFEALGIVAGVIIIVLGLHFLGLFRIGLLYRE
ARFHNVSRGVGLVGAYVVGLAFAFGWTPCVGPVLATILLVAGVDGSAAHGAVLLGAYSLG
IGLPFLLASLFSGAFIRLMARLRAQMATVEKVMGGALVLTGVLFLTGAMPKISGWLLQTF
PAFGEIG