Protein Info for TX73_023200 in Rhodopseudomonas palustris CGA009

Annotation: sulfur oxidation c-type cytochrome SoxA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR04484: sulfur oxidation c-type cytochrome SoxA" amino acids 46 to 273 (228 residues), 242.3 bits, see alignment E=1.7e-76 PF21342: SoxA-TsdA_cyt-c" amino acids 53 to 150 (98 residues), 92.1 bits, see alignment E=8.7e-31

Best Hits

Swiss-Prot: 70% identical to SOXA_STAND: L-cysteine S-thiosulfotransferase subunit SoxA (soxA) from Starkeya novella (strain ATCC 8093 / DSM 506 / CCM 1077 / IAM 12100 / NBRC 12443 / NCIB 9113)

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4468)

Predicted SEED Role

"sulfur oxidation protein SoxA" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>TX73_023200 sulfur oxidation c-type cytochrome SoxA (Rhodopseudomonas palustris CGA009)
MRPITALSAVIAVVLCTMPIVANAQDASEKEIERYREMISDPMSNPGFLAVDRGEQLWAE
KRGTKNVSLESCDLGLDAGKLEGAFAQLPRYFKDADRVMDLEQRLLWCMQNIQGLDTKDV
VARRFSGPGKPSDMEDLVAFIANKSTGMKIEPQLSHPKEQEMAAVGEELFHRRGGVMDFS
CSTCHGAEGKRIRLQALPYLAGPSKDAQVTMASWPTYRVSQSALRTFQHRLWDCYRQQRW
PAPEYGSDGITALTLYLNKIAAGGELAVPSIKR