Protein Info for TX73_023190 in Rhodopseudomonas palustris CGA009

Annotation: thiosulfate oxidation carrier complex protein SoxZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF08770: SoxZ" amino acids 10 to 104 (95 residues), 112.1 bits, see alignment E=4.2e-37 TIGR04490: thiosulfate oxidation carrier complex protein SoxZ" amino acids 10 to 105 (96 residues), 108.5 bits, see alignment E=6.3e-36

Best Hits

KEGG orthology group: None (inferred from 99% identity to rpt:Rpal_4959)

MetaCyc: 56% identical to SoxZ (Paracoccus pantotrophus)

Predicted SEED Role

"Sulfur oxidation protein SoxZ" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>TX73_023190 thiosulfate oxidation carrier complex protein SoxZ (Rhodopseudomonas palustris CGA009)
MSVKPTPRVRVPTQAKPGELIEIKTLISHEMESGQRKDASGKIVPRKIINTFTAQFNGKT
VFEAEWNPAISANPYQSFFYKASETGEFAFLWKDDDGSVYESKQKLTVA