Protein Info for TX73_023180 in Rhodopseudomonas palustris CGA009

Annotation: sulfite dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 10 to 37 (28 residues), 17.6 bits, see alignment (E = 3.9e-07) TIGR04555: sulfite dehydrogenase" amino acids 12 to 428 (417 residues), 630.1 bits, see alignment E=1.7e-193 PF00174: Oxidored_molyb" amino acids 118 to 280 (163 residues), 185.3 bits, see alignment E=7e-59 PF03404: Mo-co_dimer" amino acids 300 to 415 (116 residues), 64.2 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: K00387, sulfite oxidase [EC: 1.8.3.1] (inferred from 100% identity to rpa:RPA4464)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>TX73_023180 sulfite dehydrogenase (Rhodopseudomonas palustris CGA009)
MSEKPTSDVLNRRRFLGAAGLGAAGLAGAGSMLPSLAAKASEAAKPDPAITEIKDWNRYL
GDGVDKRPYGVPSKFEKDVIRRDVSWLTASPESSVNFTPLHALDGIITPSGLCFERHHGG
VAEIDPAQHRLMIHGLVDTPLVFTMDDIKRMPRVNKIYFLECAANSGMEWRGAQLNGCQF
THGMIHNVMYTGVTLKTLLEQAGVKSNAKWLLLEGADSAGMDRSLPLEKALDDVMIAYAM
NGEALRPENGYPLRAVIPGWQGNLWVKWLRRIEVGDMPWQTREETSKYTDLMPDGRARKH
TFVMDAKSVITSPSPQMPLKFKGRNVLTGIAWSGRGTVKRVDVSMDGGRNWCEARIDGPV
LNKSIVRFYVDFDWNGEELMLQSRAIDETGYVQPTKAELRKIRGVNSVYHNNGIQTWLVH
PDGVTENVEIA