Protein Info for TX73_023095 in Rhodopseudomonas palustris CGA009

Annotation: cache domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 563 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details PF08269: dCache_2" amino acids 39 to 190 (152 residues), 142.6 bits, see alignment E=3.8e-45 PF17200: sCache_2" amino acids 39 to 189 (151 residues), 170.7 bits, see alignment E=5.5e-54 PF17201: Cache_3-Cache_2" amino acids 72 to 190 (119 residues), 51 bits, see alignment E=3.6e-17 PF00672: HAMP" amino acids 210 to 258 (49 residues), 42.2 bits, see alignment 2e-14 PF00015: MCPsignal" amino acids 364 to 526 (163 residues), 114 bits, see alignment E=1.8e-36

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to rpa:RPA4449)

Predicted SEED Role

"Methyl-accepting chemotaxis receptor/sensory transducer precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (563 amino acids)

>TX73_023095 cache domain-containing protein (Rhodopseudomonas palustris CGA009)
MLSRLHLTIGRRIYLLIGLGFVGLIGLTLLDSRELATGLQQQKQIELKHLAELAISFVKD
EYDAAQRGEISTDQAQKRAEARIAKLRYGGNEYFFITDMQSKMLMHPIAKQLVGQDQSNA
KDPNGKMLFVEMVNTVRRSGSGFVDYVWPKPGSDKPQPKLTFVAGFEPWGWVIGTGVYID
DLDAQTWSAMQRSLIAATLVLLITIAVSVFMARRITRPILAMTGAMKDLAGGRIDIEVPG
IGRHDEIGEMAEAVEVFKLNAQERRRLEGERQEIEARAEAERRAHANQVAEAFERAIGEI
VETVSAASDELEASATTLTRTAEQSQELATAVAAASEEASTNVQSVASATEEMSSSVNEI
SRQVQESARIAHEAVDQARQTNGRVEELAKAASRIGDVVELISNIAGQTNLLALNATIEA
ARAGEAGRGFAVVASEVKALAEQTAKATGEITLQINGIQAATDQSVAAIKEIGETIAKMS
EISSTIASAVEEQGAATQEISRNVQQASLGTQQVSSNITDVQRGATETGAASAQVLAAAK
SLSGDSNRLKVEVSNFLDSVRAA