Protein Info for TX73_022840 in Rhodopseudomonas palustris CGA009

Annotation: carbohydrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 9 to 28 (20 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 177 to 203 (27 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 7 to 261 (255 residues), 26.8 bits, see alignment E=2e-10

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 98% identity to rpb:RPB_4213)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein GlpQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>TX73_022840 carbohydrate ABC transporter permease (Rhodopseudomonas palustris CGA009)
MHSIPGRRIVMALYLLFLMLPIYWLVNMSFKTNGEIVSTMTLWPHQPTLENYRTIFTDPS
WYSGYINSLQYVVINTVLSISFALPAAYAFSRYRFLGDKHLFFWLLSNRMAPAAVYALPF
FNLYSALNLFDTPWAVALAHCLFNVPLAVWILEGFVSGVPKEIDETAFLDGYSFPRFFVK
ILMPLIASGIGVAAFFCFMFSWVELLLARTLTSVNAKPISAVMTRTVSAAGMDWGLLAAA
GVLTIIPGALVIWFVRNYIARGFALGRV