Protein Info for TX73_022815 in Rhodopseudomonas palustris CGA009

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 220 to 248 (29 residues), see Phobius details amino acids 263 to 291 (29 residues), see Phobius details amino acids 298 to 318 (21 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 38 to 302 (265 residues), 105.1 bits, see alignment E=1.8e-34

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 99% identity to rpt:Rpal_4886)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>TX73_022815 branched-chain amino acid ABC transporter permease (Rhodopseudomonas palustris CGA009)
MMILSGDPPRSRVLSLLLITIVVVLAITPFVFPGAKPLNVAAKICIFAALVASYDLLLGY
TGTVSFAHTMFYGIGSYAVAIALYGMGPSWAAVGAGVLIGLPLAALLALVIGLFSLRVEA
IFFAMITLAVASAFLVLASQLSWLTGGEDGRSFSLPELLRPGTVFVKDFFGVRINGRILT
YYIILVGCAGMILALLRVVNSPFGRVLQAVRENRFRAEALGYRTVFHLTYANVLAALVAA
AAGVLNAMWLRYAGPDTSLSFSIMLDILLMVVIGGMGTIYGAIIGATIFILAQNYLQALM
GAASGAAADAGLPLLPNLLHPDRWLLWLGLLFVASVYFFPTGIVGRLRGAPKVAD