Protein Info for TX73_022750 in Rhodopseudomonas palustris CGA009

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 199 to 226 (28 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details amino acids 323 to 340 (18 residues), see Phobius details amino acids 346 to 362 (17 residues), see Phobius details PF21088: MS_channel_1st" amino acids 324 to 363 (40 residues), 23.1 bits, see alignment 8.7e-09 PF00924: MS_channel_2nd" amino acids 365 to 431 (67 residues), 67.6 bits, see alignment E=1.3e-22 PF21082: MS_channel_3rd" amino acids 443 to 521 (79 residues), 22.1 bits, see alignment E=2.6e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4389)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (567 amino acids)

>TX73_022750 mechanosensitive ion channel (Rhodopseudomonas palustris CGA009)
MTSSARALFRALILVATMTLVVASSAFAQIPGTNGNGAAPAQPAAPTDPLGRETPAGMVA
GFIAAAAEQNYERAAMYLDLSQEKDAWGPSVAQQLQRILDRGGVVFSRLRLSTEPQGDQD
DSLPPEQEKFGMVRTDHGTVDLIAQRVEGKDGVKIWLVSARTVSELPELSRTVVSSSVDK
LLPYALRDEYRFAGVPIGHWIAVIVLAFVCFGAVWLITGAIGFIILRLRRSTGDSRIRRV
LEASALPVRLLLTAWALRIAMTLAGVAIVARQHLSGAIELLGWVALSWIIWRVVDSLAAF
AIDRMTLRGRLSMLSAVTFIRRSVKFVIIAFAIIVGFNALGYNVTAGLAALGIGGIAIAL
GAQKTIEHLVGSLTLVTDQPMRVGDFCKFGDTSGTIEDIGMRSTRVRTLDRTVVTVPNGA
LAALQIENFSRRDKFWFHPILELRYETSSEQIRTLLTSLREMLLDHPDVDNDPARVRLIG
LAPAALKVEIFAYVHAVDGDTFLEVQEDLMLKILELVEAAGTGFAAGSQTVYVARAKGAA
QRQGGDEDAPGTGSDGAKVRGGIPERV