Protein Info for TX73_022685 in Rhodopseudomonas palustris CGA009

Annotation: signal peptidase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details PF01252: Peptidase_A8" amino acids 12 to 155 (144 residues), 120.4 bits, see alignment E=3.7e-39 TIGR00077: signal peptidase II" amino acids 12 to 156 (145 residues), 105 bits, see alignment E=2e-34

Best Hits

Swiss-Prot: 100% identical to LSPA_RHOPA: Lipoprotein signal peptidase (lspA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 100% identity to rpa:RPA4376)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>TX73_022685 signal peptidase II (Rhodopseudomonas palustris CGA009)
MTPVRLGVLAGIVALVLDQVTKLWLLYGFELARKGVVQVLPFFDLVLAWNTGISYGWFSG
QGPTGQILMLAFKAVAIVALAIWMARSTTKLATIGLGLIIGGAIGNAIDRLAYGAVVDFA
LLHAEIGGKIYNWYVFNIADVAIVVGVAALLYDSLIGLPAAKAP