Protein Info for TX73_022570 in Rhodopseudomonas palustris CGA009

Annotation: redox-regulated ATPase YchF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00092: GTP-binding protein YchF
  • amino acids 1 to 364 (364 residues), 505.9 bits, E=3.4e-156
• PF02421: FeoB_N
  • amino acids 5 to 46 (42 residues), 31.1 bits, 2.4e-11
• PF01926: MMR_HSR1
  • amino acids 5 to 118 (114 residues), 81 bits, E=1.1e-26
• PF06071: YchF-GTPase_C
  • amino acids 281 to 364 (84 residues), 133.4 bits, E=3.9e-43

Best Hits

Swiss-Prot: 61% identical to YCHF_PASMU: Ribosome-binding ATPase YchF (ychF) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K06942, (no description) (inferred from 100% identity to rpx:Rpdx1_4572)

MetaCyc: 59% identical to redox-responsive ATPase YchF (Escherichia coli K-12 substr. MG1655)
Nucleoside-triphosphatase. [EC: 3.6.1.15, 3.6.1.5]

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (12/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.15

Use Curated BLAST to search for 3.6.1.15 or 3.6.1.5

Protein Sequence (365 amino acids)

>TX73_022570 redox-regulated ATPase YchF (Rhodopseudomonas palustris CGA009)
MGFKCGIVGLPNVGKSTLFNALTETAAAQAANYPFCTIEPNVGEVAVPDPRLDKLAEVGK
SQQIIPTRLTFVDIAGLVKGASKGEGLGNQFLATIREVDAIAHVVRCFEDGDITHVEGRV
APLADIETIETELMLSDLESLEKRVDNLTKKAKGGDKDSKEQLELVTRALTLLRDGKPAR
FLERKPEEERAFRMLGLLTSKPVLYVCNVEEGSAAEGNKFSEQVMARAKEEGAVAVVISA
KIESEIATLSKEERTDFLDTLGLHEAGLDRLIRAGYELLHLITYFTVGPKEARAWTITKG
TKAPQAAAVIHTDFEKGFIRAETIAYDDYIRLGGEAGARDGGKLRLEGKEYVVADGDVMH
FRFNT