Protein Info for TX73_022275 in Rhodopseudomonas palustris CGA009

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 170 to 186 (17 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details PF00892: EamA" amino acids 20 to 153 (134 residues), 76.4 bits, see alignment E=2.5e-25 amino acids 168 to 302 (135 residues), 78.6 bits, see alignment E=5.2e-26 PF06027: SLC35F" amino acids 26 to 282 (257 residues), 29.9 bits, see alignment E=4.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_4778)

Predicted SEED Role

"FIG01005520: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>TX73_022275 DMT family transporter (Rhodopseudomonas palustris CGA009)
MTTTTPPAEAHRFGWISDQAYLLLSLTSLFWAGNAIVGRAIAGHFPPVTLSFLRWTCAFL
IVAPFAWRHLIADWKVIRRHLPLMMSVSIIGISTFNTLQYTALQYTSALNVLLLQSTAPL
FVALWALIVLRMRLTLTQAIGIGSSMIGVVVIILHGNIAELAAIDLNRGDVLFVCALASF
GLYTTLTQKRPPMHALSFLGFTFGCGALFLIPLEIWELSTTPLPAFDWANLGALAYVAVF
PSILAYLCYNRGVRLIGANRSAPFFHLVPVFGSAMAILFLGEQPHLYHAVGYALVLTGVV
IAARKPKTA