Protein Info for TX73_021980 in Rhodopseudomonas palustris CGA009

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 PF01636: APH" amino acids 110 to 255 (146 residues), 31.3 bits, see alignment E=3.7e-11 PF06414: Zeta_toxin" amino acids 336 to 465 (130 residues), 34.5 bits, see alignment E=2.8e-12 PF13671: AAA_33" amino acids 340 to 483 (144 residues), 81.3 bits, see alignment E=1.8e-26 PF13238: AAA_18" amino acids 341 to 469 (129 residues), 34.1 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: K07028, (no description) (inferred from 100% identity to rpa:RPA4242)

Predicted SEED Role

"Mll6593 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>TX73_021980 AAA family ATPase (Rhodopseudomonas palustris CGA009)
MSTPDATSPGSQQQDVFDFLGRGAGDAPVVRIDTHGAAVFLEGNRAMKIKRAVKFPFLDY
STLAKRKIACEQELEVGHRFAPTIYRRVVPITRTDKGALQIGGEGPAVEWAVEMMRFDDS
ATLDHLARAGSLGPGLIDAVADAIAASHQAAPLAATAPWGASIEPILADDTNELAAGGFA
AADVAALDNGSRNALGRLRPLLEQRGVAGFVRWCHGDLHLANIVVIDGKPTLFDAIEFDP
ALASVDVLYDLAFPLMDLLHYGRGSDSAQLLNRYLAVTNADNLDALSALPLLLSMRAAIR
AKVMLARPAADETIRRANRAIAESYFELALRLIAPPPPRLIAVGGLSGTGKSVLARALSG
NVPPLPGAVVLRSDVARKRLHGVADTERLPATAYTTEVTEAVYRGLVERAAHILKQGHSV
IVDAVFSKPEERDAIESVAAGLGISFHGLFLTADLATRVARVAGRTADASDATPEIVRQQ
QSYAQGVIGWTSIDAGGTPAETLSRAVAALPQTAQVCST