Protein Info for TX73_021880 in Rhodopseudomonas palustris CGA009

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 170 to 192 (23 residues), see Phobius details amino acids 223 to 250 (28 residues), see Phobius details amino acids 256 to 283 (28 residues), see Phobius details amino acids 291 to 311 (21 residues), see Phobius details amino acids 327 to 355 (29 residues), see Phobius details PF01594: AI-2E_transport" amino acids 42 to 358 (317 residues), 139.1 bits, see alignment E=1e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_4702)

Predicted SEED Role

"transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>TX73_021880 AI-2E family transporter (Rhodopseudomonas palustris CGA009)
MTQTLGGPLRALPEPTGTPLPDSQDERPPLIRRTEVVTFTLVALLVILLVGLLYVGKPFF
LPMVTAFVVGTMVSPAASFLERFRIPRAVSAVLIVTLGLGTVIFMIGLISAPLIEWSSRI
PEIGSLLRDKLHVLDRPLQMWRQIQSSLSGSESLPQPSVQMPKIDWVFEFLSPTLTEVLL
FLVMLVLFVAGWKDLRRSLVMNFAGREARLRTLRILNEIEGSLGAYLLTVTVINLCYGAA
TGLLCAAAGMPNPAGLGALAAVLNFIPIIGPFVMFVIMTVVGIISMPTLGAGLLAPFGFV
LLTFFEGHFITPTIIGRRLSLNTLAVFITLAFWTWLWGPMGSFLASPLLIVGLVLKEHLM
PEDSPQLPGSD