Protein Info for TX73_021805 in Rhodopseudomonas palustris CGA009

Annotation: 3-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 7 to 261 (255 residues), 378.5 bits, see alignment E=6.8e-118 PF00106: adh_short" amino acids 7 to 198 (192 residues), 177.7 bits, see alignment E=3e-56 PF08659: KR" amino acids 8 to 167 (160 residues), 26.6 bits, see alignment E=8e-10 PF13561: adh_short_C2" amino acids 15 to 260 (246 residues), 191.5 bits, see alignment E=2.7e-60

Best Hits

Swiss-Prot: 52% identical to BDHA_CUPNH: D-beta-hydroxybutyrate dehydrogenase (hbdH1) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 99% identity to rpt:Rpal_4687)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>TX73_021805 3-hydroxybutyrate dehydrogenase (Rhodopseudomonas palustris CGA009)
MTNLTGKTAVVTGSTSGIGLSYARAFAKAGANVVINGMGDADAIEKERKAIESEFAVKAV
YSPADMLKPAEIAEMIKLGETTFGSVDILVNNAGIQFVSPIEDFPIEKWDAIIGINLSSA
FHGIRAAVPGMKKRGWGRIINTASAHSLVASPFKSAYVAAKHGIAGLTKTVALELATHKI
TCNCISPGYVWTPLVEKQIPDTMKARGLSKEQVINDVLLAAQPTKQFVTPEQVAALAVYL
CGDDASQITGANLSMDGGWTAA