Protein Info for TX73_021710 in Rhodopseudomonas palustris CGA009

Annotation: L,D-transpeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 724 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF20142: Scaffold" amino acids 182 to 315 (134 residues), 121.7 bits, see alignment E=6e-39 PF01471: PG_binding_1" amino acids 360 to 403 (44 residues), 31.3 bits, see alignment 2.9e-11 PF03734: YkuD" amino acids 437 to 580 (144 residues), 82.4 bits, see alignment E=7.7e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4188)

Predicted SEED Role

"FIG01004475: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (724 amino acids)

>TX73_021710 L,D-transpeptidase family protein (Rhodopseudomonas palustris CGA009)
MRDHSTGRRGFEGVLMAVAATFLTVSATSVLAQSPTRSPADLAIDAAVPVPSPVDLPPPS
VGDFKPETHAAKPETAAAPAPTEPAKDVAATPAPAAPEPSKDTAATAPATEPKTEAPAAT
ATAPAAVPAKPATDQAETTKPAEPQKPASMVAAADQPVAEQLRDLIAKSASRYFERKSER
SAVEKFYETRDYAPVWTKSGSLTAQAKGVIARLKDAAADGLDPDDYPVPSFTAATSPEAL
AEAELRLTESMMDYARQAQSGRMHWSQVSADIQYPEHPIDPAQVLAKVTTAADASAALDS
YNPPHKLYRELKKKLAELRGEGDKPVIKIADGETLRYQPARKKRAEVKMDDPRVPQLRAR
LGVTENPDSTTYDATVAAAVRKFQDHADLKASGVLDERTVKALNTPKRDRTIDTIIVNME
RWRWLPRDLGAPSLGDAYVILNIPDYTLKVMQHGAEVWTTRVVTGKPGKHATPLLTETMK
YITVNPTWNVPPSIIYNEYLPALQQDPTVLDRMGLKLERNRDGSIHISQPPGEANALGRI
RFNFPNKFLVYQHDTPDKNLFAREERAFSHGCMRVQNPDVYASTLLNIAMPEKDYTPAKV
RAMYGRSEVDLKFPTPIPVNITYQTAFVDDAGKLQLRKDVYGRDAAMLALLKNEKGKNLE
AVVAHAQPNYSRPTRLPDGVSVAGDYTGSSGASSSPFSFLENLFGGPQPRQQPAQRNQRR
VYAR