Protein Info for TX73_021575 in Rhodopseudomonas palustris CGA009

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 187 to 204 (18 residues), see Phobius details amino acids 210 to 231 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 99 to 268 (170 residues), 102.1 bits, see alignment E=1.6e-33

Best Hits

Swiss-Prot: 39% identical to Y3424_BRUAB: Probable ABC transporter permease protein BruAb2_1124 (BruAb2_1124) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to rpt:Rpal_4641)

MetaCyc: 35% identical to taurine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"FIG01004675: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>TX73_021575 ABC transporter permease (Rhodopseudomonas palustris CGA009)
MEAEADAGRLPVETMRPRFAMIQNAFAGRPMRAAVGLTAFFAIWQAITQLNLVDGFLLPS
PVAIAEALWELALDGSLWVHLGASLQRVAVGFLLACVVGLTLGLICGWWRTVSDYVRPVI
EALRPIPPLAWIPITILWFGLGDAASYFLVFLGAVFPVFIATYTAIRGLDRNQMNAALCL
GAKPWQLFTDVLIPASLPIILPGLRIALGVGWMCVVTAELIAAQTGLGYLIQQSRMLFQI
NNVVAGMVTIGLIGFAMSAILERIERRVNAWAPSERS