Protein Info for TX73_021045 in Rhodopseudomonas palustris CGA009

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 40 to 63 (24 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 401 to 422 (22 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4062)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>TX73_021045 hypothetical protein (Rhodopseudomonas palustris CGA009)
MKSGHQALFAILAQRSWQAISGAVTVVMITTFLDVHEQGWYFGLLSLAALYTIFDMGLSL
VLVQTAAHEFIGLSWLKNGHIHGPRARRFEALAAWAVRHYAWLALAFGLIVTPFGFWFFS
AAPSKGPTWQMPWVILTAINAASLVLLPFLSLVEGSGGIREVYLVRLLQTVAGALLCWIA
LAGGLGLGAVVMPASAGIVIQGIWLWQRKSRLVRSVLATQIGPTNWRREIWPHQWQIAVS
WLSGYMLTQLYIPLLFAVQGAAVAGQMGLSLTLSNMLGLLALSWITRHVPDMANAVAGGD
WDRFRIQCRRDLILSCLAFLGGAAVLCIVHKLAPSHYTDRVLPFWTFAGLLLSGFLNHIQ
TSLATQLRSFRREPLVWILLAGSTLTAAAAAWGAVHYSSGGVVAAMLSVQLLLSTPASIL
LYRRCIGRWRQGLTTSLPVPGRN