Protein Info for TX73_021035 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase 87 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 164 to 192 (29 residues), see Phobius details amino acids 213 to 238 (26 residues), see Phobius details amino acids 260 to 290 (31 residues), see Phobius details amino acids 297 to 314 (18 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details amino acids 357 to 378 (22 residues), see Phobius details amino acids 397 to 419 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4060)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>TX73_021035 glycosyltransferase 87 family protein (Rhodopseudomonas palustris CGA009)
MKQIFARLRCILWNGRLGWLWLLAGFNLAWLIQVVLYTSQNGYLPAPFIYDKSDTFMDLF
HPMYWSDDPGVYIRWGSVYPPINFLILQPLKFFVTAGRDVLDAFELRSSGVSLLIALIPV
YLLLPFLVLSTRIWRPFSLAVLVPTYLSVVTAAPMLFAVERGNVILLCLPVLAFCLSAEG
ALCCVAIGLLINLKPYFAVFIVAFLLSRRWADALFVTLAAGAIYVGSGMLLDASFPWFVG
NLLSFSQNDQLFSVREMLSMPSSVSAFAAALRTYAAQSGGGAILGFDAVVVADTVEIIKW
FAILTAFGVLAYARNVPRNTILALGVVIISNLGTWVGGYSVILYIPLVPILLRMNRAYLY
LVALVVLFLPLDAVGLVAQNIGTRYSYVSDTVVTVNWTLGLGAVLRPSINLALLVALSYE
SFERYLLSRDAPFMGKQHAPGKL