Protein Info for TX73_021020 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 8 to 171 (164 residues), 81.7 bits, E=3.1e-27

Best Hits

Swiss-Prot: 31% identical to YKCC_BACSU: Uncharacterized glycosyltransferase YkcC (ykcC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 100% identity to rpa:RPA4057)

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

• protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
• protein O-mannosylation III (mammals, core M3) (1/5 steps found)
• protein O-mannosylation I (yeast) (1/8 steps found)
• protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
• protein N-glycosylation initial phase (eukaryotic) (1/19 steps found)

KEGG Metabolic Maps

• N-Glycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Protein Sequence (312 amino acids)

>TX73_021020 glycosyltransferase family 2 protein (Rhodopseudomonas palustris CGA009)
MSSRTLLSIVTPCYNEEENVEELYRRIKAAIAPITQYDFEILIIDNASEDGTAAKVKRIA
AVDPTVKLIINTRNFGHIRSPYYGIIQSTGAATIYLASDLQDPPEIIPEFIREWEKGYKL
VMAIKPISKGNALVHSLRKSYYRVLDGISDISLLSDSTGFGLYDRAVLDHIRKINDPYPY
LRGLICELGYEIKTIPFEQPRRLRGISKNNLYTLYDIAMLGVVSHSKVPIRIAAFLGFLL
GTLSVLAALAYLVLKLMYWDQFPVGVAPIVISVFFLFGVQFMFVGILGEYIGSIHTYVQR
RPTVVEKERINF