Protein Info for TX73_021020 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 2 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 8 to 171 (164 residues), 81.7 bits, see alignment E=3.1e-27

Best Hits

Swiss-Prot: 31% identical to YKCC_BACSU: Uncharacterized glycosyltransferase YkcC (ykcC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 100% identity to rpa:RPA4057)

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>TX73_021020 glycosyltransferase family 2 protein (Rhodopseudomonas palustris CGA009)
MSSRTLLSIVTPCYNEEENVEELYRRIKAAIAPITQYDFEILIIDNASEDGTAAKVKRIA
AVDPTVKLIINTRNFGHIRSPYYGIIQSTGAATIYLASDLQDPPEIIPEFIREWEKGYKL
VMAIKPISKGNALVHSLRKSYYRVLDGISDISLLSDSTGFGLYDRAVLDHIRKINDPYPY
LRGLICELGYEIKTIPFEQPRRLRGISKNNLYTLYDIAMLGVVSHSKVPIRIAAFLGFLL
GTLSVLAALAYLVLKLMYWDQFPVGVAPIVISVFFLFGVQFMFVGILGEYIGSIHTYVQR
RPTVVEKERINF