Protein Info for TX73_020980 in Rhodopseudomonas palustris CGA009

Annotation: CDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 TIGR02622: CDP-glucose 4,6-dehydratase" amino acids 6 to 354 (349 residues), 508.7 bits, see alignment E=4.4e-157 PF01370: Epimerase" amino acids 12 to 248 (237 residues), 93.2 bits, see alignment E=3.6e-30 PF16363: GDP_Man_Dehyd" amino acids 14 to 329 (316 residues), 107.4 bits, see alignment E=2.2e-34 PF02719: Polysacc_synt_2" amino acids 57 to 232 (176 residues), 52.2 bits, see alignment E=1.1e-17 PF01073: 3Beta_HSD" amino acids 57 to 179 (123 residues), 25.9 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 62% identical to RFBG_SALTY: CDP-glucose 4,6-dehydratase (rfbG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01709, CDP-glucose 4,6-dehydratase [EC: 4.2.1.45] (inferred from 100% identity to rpa:RPA4049)

MetaCyc: 63% identical to CDP-D-glucose-4,6-dehydratase monomer (Yersinia pseudotuberculosis)
CDP-glucose 4,6-dehydratase. [EC: 4.2.1.45]

Predicted SEED Role

"Similar to CDP-glucose 4,6-dehydratase (EC 4.2.1.45)" (EC 4.2.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>TX73_020980 CDP-glucose 4,6-dehydratase (Rhodopseudomonas palustris CGA009)
MIQPAFWRGKRVFLTGHTGFKGSWLSIWFAELGADVVGFALPPPTEPSLFEVAGLARRMN
SIIGDVRNADALCSAMQEARPEIVIHMAAQPLVRLSYHQPVETYATNVMGLVHVFEAVRK
CQSVRAVVNVTSDKCYENKEWVWGYRESEPMGGYDPYSSSKGCAELVTTAYRNSFFNPEN
YQTHGVAIASARAGNVIGGGDWAPDRLIPNIMRAIETGIPVQIRNPAAIRPWQHVLEPLG
GYLCLAKKLYEAGPAFVGGWNFGPADSDAKPVQWIVDRMTRMWGKGASWQEVTDRTAPHE
AHYLKLDCSKAQSLLGWKPAWNLERALEKIIDWHHSSLQGADLHAKTLGQIRDYQADFFK
TVAP