Protein Info for TX73_020975 in Rhodopseudomonas palustris CGA009

Annotation: glucose-1-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02623: glucose-1-phosphate cytidylyltransferase
  • amino acids 1 to 254 (254 residues), 488.1 bits, E=2.8e-151
• PF00483: NTP_transferase
  • amino acids 2 to 202 (201 residues), 59.5 bits, E=3.8e-20
• PF12804: NTP_transf_3
  • amino acids 3 to 67 (65 residues), 29.2 bits, E=1e-10

Best Hits

Swiss-Prot: 65% identical to RFBF_SALTY: Glucose-1-phosphate cytidylyltransferase (rfbF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00978, glucose-1-phosphate cytidylyltransferase [EC: 2.7.7.33] (inferred from 100% identity to rpa:RPA4048)

MetaCyc: 68% identical to glucose-1-phosphate cytidylyltransferase (Yersinia enterocolitica (type O:8))
Glucose-1-phosphate cytidylyltransferase. [EC: 2.7.7.33]

Predicted SEED Role

"Glucose-1-phosphate cytidylyltransferase (EC 2.7.7.33)" in subsystem dTDP-rhamnose synthesis (EC 2.7.7.33)

MetaCyc Pathways

• CDP-4-dehydro-3,6-dideoxy-D-glucose biosynthesis (2/3 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• superpathway of CDP-glucose-derived O-antigen building blocks biosynthesis (2/8 steps found)
• streptomycin biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.33

Protein Sequence (255 amino acids)

>TX73_020975 glucose-1-phosphate cytidylyltransferase (Rhodopseudomonas palustris CGA009)
MKVVLLAGGLGTRISEESALRPKPMIEIGGRPILWHIMKIYLAHGLRDFVICCGYKGYMI
KEYFANYSLHMSDITIDMENESIEIHRKKTEPWRVTLVDTGEATQTGGRLKRIADYIDGD
FCLTYGDGVGSINITELLMFHRSHGKPATMTATQPPGRFGALQLNGKSVTSFLEKPTGDG
GWINGGFFVLSPKVLDRIDGDMTIWEREPLESLAQNGELQAYFHSGFWQPMDTLRDKNHL
ENLWQSGRAPWKMWE