Protein Info for TX73_020925 in Rhodopseudomonas palustris CGA009

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 88 to 121 (34 residues), see Phobius details amino acids 127 to 143 (17 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details PF20967: MASE7" amino acids 45 to 176 (132 residues), 37 bits, see alignment E=1.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpa:RPA4039)

Predicted SEED Role

"FIG01004483: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (192 amino acids)

>TX73_020925 hypothetical protein (Rhodopseudomonas palustris CGA009)
MLPPALLRAADWFRAYADNPDPLAATGNLVALVLAGNGPFYPLYVAFVGGTGGMPWLLLT
LLSFPCFLAVPALARVQSRLGRVTLSLIATGNTMFCAWLLGVPSGVELFLLPCAMLASVL
FRPSERLLMLPLAGLPVAAYLFLHDRYAPPPHSYQPAEYAGLFSMNAFSAAMISIFIGMV
FSRLYTADRTDT