Protein Info for TX73_020835 in Rhodopseudomonas palustris CGA009

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 32 to 51 (20 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 31 to 293 (263 residues), 153.1 bits, see alignment E=4.3e-49

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to rpa:RPA4021)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>TX73_020835 branched-chain amino acid ABC transporter permease (Rhodopseudomonas palustris CGA009)
MPNLFGRRSVILIALAVVMAVLPLLFPSSYYFRVASLVWVSALAAIGLNILMGKAGQVSL
GHAGFFGIGAYAVAIGPAHLGLNALLAVLVGALLSALLAFLVGRPILRLKGHYLAIATLG
LGVLVAMVITTESGWTGGPDGMPVPKLSLFGWRISGSNTWYWITAGLLLIGTWFALNLDD
TPTGRAFRALHDSEIAARTAGVHVERFKLQAFVIAAVYASIAGSALAMMNGFVNPDQAGF
LHSVELVTMVVLGGLGSIVGSIVGAAVLVVLPQLLTVFQDYEHFLLGLIIIVSMIFMRDG
MVPMLAKLTMRARR