Protein Info for TX73_020830 in Rhodopseudomonas palustris CGA009

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 179 to 206 (28 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 274 (267 residues), 137.8 bits, see alignment E=2e-44

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 99% identity to rpx:Rpdx1_4279)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>TX73_020830 branched-chain amino acid ABC transporter permease (Rhodopseudomonas palustris CGA009)
MSELLQFLISGLTVGAVYALVALGFTLVYHASDVVNFAQGEFVMLGGMVTVFAYAAGLPL
PLAALLAVIVAVVVGLLLYWLAIAPARGASAVSLIIITIGASILLRGAAQIVFDKQFHKL
PAFSGDAPIHLLGAVIQPQSLWVLGGAALVVLTLYYVMERTLIGKAVVATAANRLAARLV
GVNVATVMALAFGGSAAIGAIAGILITPITLTSYDVGTLLALKGFAAAMLGGMGNPLGAV
IGGLLLGLLESFGAGYVSSTYKDAIAFIVILAVLFVAPQGLVGRRTVERV