Protein Info for TX73_020625 in Rhodopseudomonas palustris CGA009

Annotation: NAD-dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 167 (163 residues), 59 bits, E=1.3e-19
• PF02719: Polysacc_synt_2
  • amino acids 6 to 231 (226 residues), 33 bits, E=1.1e-11
• PF01370: Epimerase
  • amino acids 6 to 257 (252 residues), 189.5 bits, E=2.1e-59
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 318 (312 residues), 157.1 bits, E=2.5e-49
• PF01073: 3Beta_HSD
  • amino acids 7 to 278 (272 residues), 65.4 bits, E=1.3e-21

Best Hits

Swiss-Prot: 60% identical to YCL2_ECO11: Uncharacterized 37.6 kDa protein in cld 5'region from Escherichia coli O111:H-

KEGG orthology group: K01795, [EC: 5.1.3.-] (inferred from 100% identity to rpa:RPA3980)

MetaCyc: 46% identical to UDP-glucuronate 4-epimerase (Streptococcus pneumoniae)
UDP-glucuronate 4-epimerase. [EC: 5.1.3.6]

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

MetaCyc Pathways

• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galacturonate biosynthesis I (from UDP-D-glucuronate) (1/1 steps found)
• UDP-sugars interconversion (5/9 steps found)
• L-ascorbate biosynthesis V (euglena, D-galacturonate pathway) (2/7 steps found)

KEGG Metabolic Maps

• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Starch and sucrose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.- or 5.1.3.6

Protein Sequence (330 amino acids)

>TX73_020625 NAD-dependent epimerase (Rhodopseudomonas palustris CGA009)
MAETAVLVTGAAGFIGYHVARELLEAGNVVVGLDSLNDYYDPALKQARLDLLTPYPGFSF
VHADLSDRPAIADLFAKHRFPVVIHLAAQAGVRHSLSHPHDYADSNLEGFLNVLEGCRHN
GCSHLIYASSSSVYGANTKLPFSVDDPTDHPISLYAATKKANELMAHCYSHLYRLPTTGL
RFFTIYGPWYRPDMALYLFARAITEGRPIKLFNHGKMRRDFTFVDDVTRVVTKLMTLVPT
AEPGQNGGAPARVYNVGNHSPEELMHVVALLERELGRPAIKEMLPMQPGDVPETFADVEA
LFRDVGFRPSTPIEDGVRAFVRWFRDYHRV