Protein Info for TX73_020620 in Rhodopseudomonas palustris CGA009

Annotation: Gfo/Idh/MocA family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01408: GFO_IDH_MocA
  • amino acids 13 to 130 (118 residues), 101.1 bits, E=7.1e-33
• PF02894: GFO_IDH_MocA_C
  • amino acids 168 to 313 (146 residues), 28.2 bits, E=1.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to rpt:Rpal_4502)

Predicted SEED Role

"Myo-inositol 2-dehydrogenase (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

• myo-inositol degradation II (1/5 steps found)
• myo-inositol degradation I (2/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (2/10 steps found)
• streptomycin biosynthesis (3/18 steps found)

KEGG Metabolic Maps

• Inositol phosphate metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.18

Protein Sequence (331 amino acids)

>TX73_020620 Gfo/Idh/MocA family oxidoreductase (Rhodopseudomonas palustris CGA009)
MTSSTETAKTPSLRIGVIGAGVMGTNHGRVLAGLPGVSLVGIVDPLPEHRDRAVELIGCK
TFATLDELLLAGVDAVTIAAPTHLHHEVALTCIGRGIHVLVEKPIASTVAEGREIVAAAE
KAGVTLMVGHVERFNPAVAAIKQAIRDEDILSIGITRVGPFPPRMSNVGVVIDLAVHDID
LIRWFTDSEITEVQPQLSSAIAEREDIALLQFRTASGVLAHINTNWLTPFKARTVTVATR
GKYVMGDLLTRQVTECFGFKADGSYSMRHLPVGHDEPLRAELIAFVNAVSSNGPPAVTGE
EGVASLEIAIQCLDQPARPAATAAAPRRAAG