Protein Info for TX73_020460 in Rhodopseudomonas palustris CGA009

Annotation: glycosyltransferase family 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF00534: Glycos_transf_1" amino acids 251 to 370 (120 residues), 50.1 bits, see alignment E=2.4e-17 PF13692: Glyco_trans_1_4" amino acids 256 to 395 (140 residues), 34.5 bits, see alignment E=2.4e-12

Best Hits

KEGG orthology group: K00754, [EC: 2.4.1.-] (inferred from 100% identity to rpa:RPA3949)

Predicted SEED Role

"glycosyl transferase, group 1 family protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>TX73_020460 glycosyltransferase family 1 protein (Rhodopseudomonas palustris CGA009)
MDQTADRHEQPWLWMDVSTSARARSGQMNGTLRVEQSYIRALSAEMAPGLRFCRYDQLRR
DYVAVATPPDLSGKPVAGKAKSKQASGIAAVLKPIGKSVERTVKTAVRGATASLLRKASQ
AEPLPKLGGDGLSEVLFLAGENWSRVDFATVARMRRERGTKVAALCQDFIPAVAPQFFAG
GDFVTKFDAYAQFLIKETDLVVSISEATKRDILGYAQRHGGMHGAVEIVHLGADIPAPQA
ARRPEALTDAQAKRFVISVSTIQSRKNFDLLYHLWHRLTEQNTLALPTLVIVGQPGFGSS
DLLWQIANDPVTANSILHLPRAGDDELAWLYQHCLFTLYPSFYEGWGLPVSESLAFGKYC
LASDASSLPEAGAGLARHLDPLDFPAWRAAVLDLIAAPEQLARHEAAIRAGYRPVTWAQS
ATRLADVLRGLAATGASAHPR